PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0032300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 304aa    MW: 33859.2 Da    PI: 6.5113
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0032300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-183276147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r rW++eE+e+++da  ++G + Wk+I +++g ++t  q++s+ qky
  ORGLA01G0032300.1 32 RERWSEEEHERFLDALIMYGRD-WKKIEEHVG-TKTTIQIRSHAQKY 76
                       78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-182682IPR009057Homeodomain-like
PROSITE profilePS5129420.7692781IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-92983IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-183079IPR006447Myb domain, plants
SMARTSM007171.3E-123179IPR001005SANT/Myb domain
PfamPF002492.2E-143276IPR001005SANT/Myb domain
CDDcd001671.91E-103477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDRNTNNNSN SSSSSEMPGK KARKPYTITK PRERWSEEEH ERFLDALIMY GRDWKKIEEH  60
VGTKTTIQIR SHAQKYFLKV QKMGLAAGLP PQYPRRRLVM QQQQSSPAGS SSVAAPAILH  120
GQPQCLPPHH NVAVQSSIGW DCPGVLPPAT NDMQNLEWAS TSGAAAWGNH HGLIEPTAAF  180
DSFPGESSFM GAASFSNMSM DWTGTTSEMV TASIVQDETI ELPLSPDDMQ FAQVYRFIGD  240
IFDPDSPCPV ETHLQKLKNM DVITVKTILL VLRNLEDNLL SPQFEPIRRL LSTYDPNRGL  300
SGHL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069690.0AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.10.0PREDICTED: protein REVEILLE 8
TrEMBLI1NKD30.0I1NKD3_ORYGL; Uncharacterized protein
STRINGORGLA01G0032300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.15e-48MYB_related family protein